PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 306aa    MW: 34656.9 Da    PI: 7.0513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1815genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-182572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++++G g+W+  a++ g++Rt+k+c++rw++yl
      Gh_D01G1815 25 RGPWTLEEDTLLTHYIARHGEGRWNMLAKCAGLKRTGKSCRLRWLNYL 72
                     89********************************************97 PP

2Myb_DNA-binding52.61e-1678121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_D01G1815  78 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6752072IPR017930Myb domain
SuperFamilySSF466895.24E-3123119IPR009057Homeodomain-like
SMARTSM007175.8E-152474IPR001005SANT/Myb domain
PfamPF002491.0E-152572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-232679IPR009057Homeodomain-like
CDDcd001671.23E-112772No hitNo description
PROSITE patternPS0017504049IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.75173127IPR017930Myb domain
SMARTSM007172.7E-1577125IPR001005SANT/Myb domain
PfamPF002491.1E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2380126IPR009057Homeodomain-like
CDDcd001679.82E-1282121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MRAAMPPINT KNMSTPLEEE SELRRGPWTL EEDTLLTHYI ARHGEGRWNM LAKCAGLKRT  60
GKSCRLRWLN YLKPDIKRGN LTPQEQLLIL ELHSKWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKQARQL NIESNSQRFL DAVRCFWMPR LVQKVEQASP SSSSSSSSSS SYLKEMCTQS  180
SVPSQLSSCC TVPSFPTVSP LANKTTDISN SSSVTTQNIC PTDSINNISD QTEIPQHLTG  240
SNVYGHTTLD QCYNIDSNDY GMEGISFASI SGVGFYEGTP SEGNWMCNEM SDDLWNMDDI  300
WQLRSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-252212724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2430920.0AC243092.1 Gossypioides kirkii clone GKH058K14-jmr, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467885.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0D2RAK10.0A0A0D2RAK1_G
STRINGPOPTR_0008s12130.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-90myb domain protein 62